PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00023528-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 211aa    MW: 24323.1 Da    PI: 4.8158
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00023528-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161966148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W +eEde+l   v ++G ++W++Iar  g+ R++k+c++rw +yl
  WALNUT_00023528-RA 19 KGPWVEEEDERLTTFVSLMGERRWDSIARASGLQRSGKSCRLRWMNYL 66
                        79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-191468IPR009057Homeodomain-like
PROSITE profilePS5129422.8261470IPR017930Myb domain
SMARTSM007171.5E-131868IPR001005SANT/Myb domain
PfamPF002495.2E-141966IPR001005SANT/Myb domain
SuperFamilySSF466891.8E-192093IPR009057Homeodomain-like
CDDcd001671.33E-102166No hitNo description
Gene3DG3DSA:1.10.10.602.0E-56993IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MLQTTMAYQV AMQGGRLRKG PWVEEEDERL TTFVSLMGER RWDSIARASG LQRSGKSCRL  60
RWMNYLRPDL KHGQLSIDEE RIILQLHELW GNKLGNFHSK INNAEQDFFF HEQGGMTTVR  120
YQCGNKGSVD KDSWGTMNDI SSDALGFSDL QFTCSPYETR LSDWISGVSD DQSKIKHQED  180
CNTIESCCCY LAWISDNSNT WDYSGSLWDM D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-14179325100MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008350343.13e-66PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB59-like
RefseqXP_008387530.13e-66PREDICTED: transcription factor MYB59
TrEMBLA0A061ESZ74e-65A0A061ESZ7_THECC; Myb domain protein 27, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131692631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.19e-44myb domain protein 27